PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002292P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 379aa    MW: 42276.9 Da    PI: 6.9233
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002292P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
   MELO3C002292P1 14 KGLWSPEEDEKLFNYITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.71.5e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l++ +++ lG++ W+ Ia+ ++ gRt++++k++w++
   MELO3C002292P1  67 RGMFSQQEEDLIISLHEVLGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-25664IPR009057Homeodomain-like
PROSITE profilePS5129424.074965IPR017930Myb domain
SuperFamilySSF466897.11E-2912108IPR009057Homeodomain-like
SMARTSM007174.1E-121363IPR001005SANT/Myb domain
PfamPF002492.4E-141461IPR001005SANT/Myb domain
CDDcd001675.81E-111761No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2565116IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.04666116IPR017930Myb domain
PfamPF002491.5E-1367110IPR001005SANT/Myb domain
CDDcd001672.64E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGRHSCCLKQ KLRKGLWSPE EDEKLFNYIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIS LHEVLGNRWA QIAAQLPGRT DNEIKNFWNS SLKKKLMKQG  120
IDPNTHKPII NIQEIKEKKI FEDREFPQIP PVQGVLGGGG GVSSAVGGNQ GPAFLLGGTD  180
YYDGGLTTTT PIIRDHLMNN KQALVDSLCF YEFQTGLDSC NYNNTNNNNN NFETTQYQTN  240
MQSFGFNSVP SLTNSDHGSL SGTEFSENSG SNISNYGGFY MNNNNNNNGA VDNSTFCSWE  300
NDNNKLESYF QIEVNNNNNN NNNNGIKSEE LKKVTGGGSS MFDGQLIQSR SSIDFSSYPL  360
MSLSQHITAA NFGVFHHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008438768.10.0PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH66e-83MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0A0LRA30.0A0A0A0LRA3_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s09430.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58313353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-79myb domain protein 86